Scroll to top
Prion Protein Mutation Database

PrP Mutation Map

All residues highlighted in blue are associated with probable, possible or definite PRNP missense mutation as defined in Schematic with Pathogenicity. Some polymorphisms are included for information. Hovering over each highlighted residue will reveal the associated mutant, and clicking on each mutant will direct you to detailed clinicopathological and structural analyses. Individual level data for each mutant collated from the literature and used for analysis in the mutant sub-pages is available for download here.

1MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPG
41QGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGG
81WGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA
121VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQ
161VYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTE
201TDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV
241ILLISFLIFLIVG